MAP3K9 Antibody

Images

 
Western Blot: MAP3K9 Antibody [NBP1-82781] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: MAP3K9 Antibody [NBP1-82781] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: MAP3K9 Antibody [NBP1-82781] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: MAP3K9 Antibody [NBP1-82781] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-21Lane 4: Human cell line A-431Lane 5: Human liver tissue

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP3K9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP3K9 Protein (NBP1-82781PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP3K9 Antibody

  • EC 2.7.11
  • EC 2.7.11.25
  • MEKK9
  • mitogen-activated protein kinase kinase kinase 9
  • MLK1Mixed lineage kinase 1
  • PRKE1mixed lineage kinase 1 (tyr and ser/thr specificity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4559
Species: Hu
Applications: WB
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5066
Species: Hu
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for MAP3K9 Antibody (NBP1-82781) (0)

There are no publications for MAP3K9 Antibody (NBP1-82781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K9 Antibody (NBP1-82781) (0)

There are no reviews for MAP3K9 Antibody (NBP1-82781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAP3K9 Antibody (NBP1-82781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP3K9 Products

Bioinformatics Tool for MAP3K9 Antibody (NBP1-82781)

Discover related pathways, diseases and genes to MAP3K9 Antibody (NBP1-82781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K9 Antibody (NBP1-82781)

Discover more about diseases related to MAP3K9 Antibody (NBP1-82781).
 

Pathways for MAP3K9 Antibody (NBP1-82781)

View related products by pathway.

PTMs for MAP3K9 Antibody (NBP1-82781)

Learn more about PTMs related to MAP3K9 Antibody (NBP1-82781).
 

Research Areas for MAP3K9 Antibody (NBP1-82781)

Find related products by research area.

Blogs on MAP3K9

There are no specific blogs for MAP3K9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP3K9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K9