Recombinant Human MAP3K6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAP3K6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 225-325 of Human MAP3K6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAP3K6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAP3K6 Protein

  • apoptosis signal regulating kinase 2
  • ASK2MGC20114
  • EC 2.7.11
  • EC 2.7.11.25
  • MAPKKK6MEKK6Apoptosis signal-regulating kinase 2
  • MGC125653
  • mitogen-activated protein kinase kinase kinase 6

Background

MAP3K6 - mitogen-activated protein kinase kinase kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-52971
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for MAP3K6 Partial Recombinant Protein (H00009064-Q01) (0)

There are no publications for MAP3K6 Partial Recombinant Protein (H00009064-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K6 Partial Recombinant Protein (H00009064-Q01) (0)

There are no reviews for MAP3K6 Partial Recombinant Protein (H00009064-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP3K6 Partial Recombinant Protein (H00009064-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP3K6 Products

Bioinformatics Tool for MAP3K6 Partial Recombinant Protein (H00009064-Q01)

Discover related pathways, diseases and genes to MAP3K6 Partial Recombinant Protein (H00009064-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K6 Partial Recombinant Protein (H00009064-Q01)

Discover more about diseases related to MAP3K6 Partial Recombinant Protein (H00009064-Q01).
 

Pathways for MAP3K6 Partial Recombinant Protein (H00009064-Q01)

View related products by pathway.

Research Areas for MAP3K6 Partial Recombinant Protein (H00009064-Q01)

Find related products by research area.

Blogs on MAP3K6

There are no specific blogs for MAP3K6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAP3K6 Antibody
NBP2-14219

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAP3K6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K6