MAP3K15 Antibody

Images

 
Western Blot: MAP3K15 Antibody [NBP1-52971] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MAP3K15 Antibody [NBP1-52971] - This Anti-MAP3K15 antibody was used in Western Blot of Fetal Intestine tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP3K15 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAP3K15(mitogen-activated protein kinase kinase kinase 15) The peptide sequence was selected from the middle region of MAP3K15. Peptide sequence TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAP3K15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAP3K15 Antibody

  • Apoptosis signal-regulating kinase 3
  • ASK3MEKK 15
  • bA723P2.3
  • EC 2.7.11
  • EC 2.7.11.25
  • FLJ16518
  • MAPK/ERK kinase kinase 15
  • MEK kinase 15
  • mitogen-activated protein kinase kinase kinase 15

Background

MAP3K15 is a component of a protein kinase signal transduction cascade.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-14219
Species: Hu
Applications: ICC/IF, IHC, IHC-P
25910002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82492
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAP3K15 Antibody (NBP1-52971) (0)

There are no publications for MAP3K15 Antibody (NBP1-52971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K15 Antibody (NBP1-52971) (0)

There are no reviews for MAP3K15 Antibody (NBP1-52971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP3K15 Antibody (NBP1-52971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP3K15 Products

Bioinformatics Tool for MAP3K15 Antibody (NBP1-52971)

Discover related pathways, diseases and genes to MAP3K15 Antibody (NBP1-52971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K15 Antibody (NBP1-52971)

Discover more about diseases related to MAP3K15 Antibody (NBP1-52971).
 

Pathways for MAP3K15 Antibody (NBP1-52971)

View related products by pathway.

Research Areas for MAP3K15 Antibody (NBP1-52971)

Find related products by research area.

Blogs on MAP3K15

There are no specific blogs for MAP3K15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP3K15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K15
Uniprot