MAP3K15 Antibody


Western Blot: MAP3K15 Antibody [NBP1-52971] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MAP3K15 Antibody [NBP1-52971] - This Anti-MAP3K15 antibody was used in Western Blot of Fetal Intestine tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MAP3K15 Antibody Summary

Synthetic peptides corresponding to MAP3K15(mitogen-activated protein kinase kinase kinase 15) The peptide sequence was selected from the middle region of MAP3K15. Peptide sequence TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAP3K15 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAP3K15 Antibody

  • Apoptosis signal-regulating kinase 3
  • ASK3MEKK 15
  • bA723P2.3
  • EC 2.7.11
  • EC
  • FLJ16518
  • MAPK/ERK kinase kinase 15
  • MEK kinase 15
  • mitogen-activated protein kinase kinase kinase 15


MAP3K15 is a component of a protein kinase signal transduction cascade.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAP3K15 Antibody (NBP1-52971) (0)

There are no publications for MAP3K15 Antibody (NBP1-52971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K15 Antibody (NBP1-52971) (0)

There are no reviews for MAP3K15 Antibody (NBP1-52971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP3K15 Antibody (NBP1-52971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MAP3K15 Products

Bioinformatics Tool for MAP3K15 Antibody (NBP1-52971)

Discover related pathways, diseases and genes to MAP3K15 Antibody (NBP1-52971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K15 Antibody (NBP1-52971)

Discover more about diseases related to MAP3K15 Antibody (NBP1-52971).

Pathways for MAP3K15 Antibody (NBP1-52971)

View related products by pathway.

Research Areas for MAP3K15 Antibody (NBP1-52971)

Find related products by research area.

Blogs on MAP3K15

There are no specific blogs for MAP3K15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAP3K15 Antibody and receive a gift card or discount.


Gene Symbol MAP3K15