Mammaglobin A Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Mammaglobin A Recombinant Protein Summary

Description
Mammaglobin A (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Gene
SCGB2A2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00004250-P01.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mammaglobin A Recombinant Protein

  • mammaglobin 1
  • mammaglobin A
  • Mammaglobin-1
  • MGB1mammaglobin-A
  • MGC71974
  • Secretoglobin family 2A member 2
  • secretoglobin, family 2A, member 2
  • UGB2mammaglobin-1

Background

SCGB2A2( NP_002402, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2751
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
BAF1936
Species: Hu
Applications: WB

Publications for Mammaglobin A Recombinant Protein (H00004250-P01)(1)

Reviews for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no reviews for Mammaglobin A Recombinant Protein (H00004250-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mammaglobin A Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover related pathways, diseases and genes to Mammaglobin A Recombinant Protein (H00004250-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover more about diseases related to Mammaglobin A Recombinant Protein (H00004250-P01).
 

Pathways for Mammaglobin A Recombinant Protein (H00004250-P01)

View related products by pathway.

PTMs for Mammaglobin A Recombinant Protein (H00004250-P01)

Learn more about PTMs related to Mammaglobin A Recombinant Protein (H00004250-P01).

Blogs on Mammaglobin A

There are no specific blogs for Mammaglobin A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SCGB2A2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00004250-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046