Recombinant Human Mammaglobin A Protein

Images

 
SDS-Page: Recombinant Human Mammaglobin A Protein [H00004250-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Mammaglobin A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 93 of Human SCGB2A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SCGB2A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00004250-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mammaglobin A Protein

  • mammaglobin 1
  • mammaglobin A
  • Mammaglobin-1
  • MGB1mammaglobin-A
  • MGC71974
  • Secretoglobin family 2A member 2
  • secretoglobin, family 2A, member 2
  • UGB2mammaglobin-1

Background

SCGB2A2( NP_002402, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2751
Species: Hu
Applications: WB, ChIP, ELISA, Func, ICC/IF, IHC, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBL1-16214
Species: Hu
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF1936
Species: Hu
Applications: WB, IP
H00004250-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Mammaglobin A Recombinant Protein (H00004250-P01)(1)

Reviews for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no reviews for Mammaglobin A Recombinant Protein (H00004250-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mammaglobin A Products

Bioinformatics Tool for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover related pathways, diseases and genes to Mammaglobin A Recombinant Protein (H00004250-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover more about diseases related to Mammaglobin A Recombinant Protein (H00004250-P01).
 

Pathways for Mammaglobin A Recombinant Protein (H00004250-P01)

View related products by pathway.

PTMs for Mammaglobin A Recombinant Protein (H00004250-P01)

Learn more about PTMs related to Mammaglobin A Recombinant Protein (H00004250-P01).

Blogs on Mammaglobin A

There are no specific blogs for Mammaglobin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mammaglobin A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB2A2