Recombinant Human Mammaglobin A Protein

Images

 
Recombinant Human Mammaglobin A Protein [H00004250-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Mammaglobin A Protein Summary

Description
Mammaglobin A (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Protein/Peptide Type
Recombinant Protein
Gene
SCGB2A2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00004250-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mammaglobin A Protein

  • mammaglobin 1
  • mammaglobin A
  • Mammaglobin-1
  • MGB1mammaglobin-A
  • MGC71974
  • Secretoglobin family 2A member 2
  • secretoglobin, family 2A, member 2
  • UGB2mammaglobin-1

Background

SCGB2A2( NP_002402, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2751
Species: Hu
Applications: WB, ChIP, ELISA, Func, ICC/IF, IHC, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP

Publications for Mammaglobin A Recombinant Protein (H00004250-P01)(1)

Reviews for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no reviews for Mammaglobin A Recombinant Protein (H00004250-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin A Recombinant Protein (H00004250-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Mammaglobin A Protein Products

Related Products by Gene

Bioinformatics Tool for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover related pathways, diseases and genes to Mammaglobin A Recombinant Protein (H00004250-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin A Recombinant Protein (H00004250-P01)

Discover more about diseases related to Mammaglobin A Recombinant Protein (H00004250-P01).
 

Pathways for Mammaglobin A Recombinant Protein (H00004250-P01)

View related products by pathway.

PTMs for Mammaglobin A Recombinant Protein (H00004250-P01)

Learn more about PTMs related to Mammaglobin A Recombinant Protein (H00004250-P01).

Blogs on Mammaglobin A

There are no specific blogs for Mammaglobin A, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human Mammaglobin A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB2A2

Customers Who Bought This Also Bought

MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046
MUC-1 Antibody
NBP1-60046