Recombinant Human MAGI2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAGI2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 519-628 of Human MAGI2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAGI2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGI2 Protein

  • ACVRINP1
  • ACVRIP1
  • AIP1
  • AIP1AIP-1
  • ARIP1
  • atrophin 1 interacting protein 1
  • atrophin-1 interacting protein A
  • Atrophin-1-interacting protein 1
  • Atrophin-1-interacting protein A
  • KIAA0705activin receptor interacting protein 1
  • MAGI2
  • MAGI-2SSCAM
  • membrane associated guanylate kinase, WW and PDZ domain containing 2
  • Membrane-associated guanylate kinase inverted 2
  • membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  • SSCAM

Background

MAGI2 - membrane associated guanylate kinase, WW and PDZ domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-32665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-17210
Species: Hu
Applications: WB, ICC/IF, IP
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-30081
Species: Hu, Mu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009863-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MAGI2 Partial Recombinant Protein (H00009863-Q01) (0)

There are no publications for MAGI2 Partial Recombinant Protein (H00009863-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGI2 Partial Recombinant Protein (H00009863-Q01) (0)

There are no reviews for MAGI2 Partial Recombinant Protein (H00009863-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGI2 Partial Recombinant Protein (H00009863-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGI2 Products

Bioinformatics Tool for MAGI2 Partial Recombinant Protein (H00009863-Q01)

Discover related pathways, diseases and genes to MAGI2 Partial Recombinant Protein (H00009863-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGI2 Partial Recombinant Protein (H00009863-Q01)

Discover more about diseases related to MAGI2 Partial Recombinant Protein (H00009863-Q01).
 

Pathways for MAGI2 Partial Recombinant Protein (H00009863-Q01)

View related products by pathway.

PTMs for MAGI2 Partial Recombinant Protein (H00009863-Q01)

Learn more about PTMs related to MAGI2 Partial Recombinant Protein (H00009863-Q01).

Blogs on MAGI2

There are no specific blogs for MAGI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGI2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGI2
Entrez