MAGEB2 Antibody

Images

 
Western Blot: MAGEB2 Antibody [H00004113-B01] - Analysis of MAGEB2 expression in transfected 293T cell line. Lane 1: MAGEB2 transfected lysate (35.09 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAGEB2 Antibody Summary

Immunogen
MAGEB2 (NP_002355.1, 1 a.a. - 319 a.a.) full-length human protein. MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
Specificity
MAGEB2 - melanoma antigen family B, 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MAGEB2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
For IHC and IF applications antibody purification with Protein A will be needed prior to use.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEB2 Antibody

  • Cancer/testis antigen 3.2
  • cancer/testis antigen family 3, member 2
  • CT3.2MAGE-B2 antigen
  • DAM6MAGE XP-2 antigen
  • DSS/AHC critical interval MAGE superfamily 6
  • DSS-AHC critical interval MAGE superfamily 6
  • MAGE-XP-2
  • melanoma antigen family B, 2
  • melanoma-associated antigen B2
  • MGC26438

Background

This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45720
Species: Hu
Applications: WB, IHC, IF
NBP1-85406
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56603
Species: Hu
Applications: WB
H00002543-T01
Species: Hu
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP1-98298
Species: Hu
Applications: WB
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00004101-M01
Species: Hu
Applications: WB, ELISA
NBP2-45722
Species: Hu
Applications: WB, IHC
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
H00004113-B01
Species: Hu
Applications: WB

Publications for MAGEB2 Antibody (H00004113-B01) (0)

There are no publications for MAGEB2 Antibody (H00004113-B01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEB2 Antibody (H00004113-B01) (0)

There are no reviews for MAGEB2 Antibody (H00004113-B01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEB2 Antibody (H00004113-B01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEB2 Products

Bioinformatics Tool for MAGEB2 Antibody (H00004113-B01)

Discover related pathways, diseases and genes to MAGEB2 Antibody (H00004113-B01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEB2 Antibody (H00004113-B01)

Discover more about diseases related to MAGEB2 Antibody (H00004113-B01).
 

Pathways for MAGEB2 Antibody (H00004113-B01)

View related products by pathway.

PTMs for MAGEB2 Antibody (H00004113-B01)

Learn more about PTMs related to MAGEB2 Antibody (H00004113-B01).

Blogs on MAGEB2

There are no specific blogs for MAGEB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEB2
Entrez
Uniprot