LYZL6 Antibody

Images

 
Immunohistochemistry: LYZL6 Antibody [NBP2-49072] - Staining of human testis shows strong cytoplasmic positivity in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYZL6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYZL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LYZL6 Recombinant Protein Antigen (NBP2-49072PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYZL6 Antibody

  • EC 3.2.1.17
  • LYC1lysozyme homolog
  • lysozyme-like 6
  • lysozyme-like protein 6
  • PRO1485
  • TKAL754
  • UNQ754

Background

Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widelydistributed in the animal kingdom and play a mainly protective role in host defense. LYZL6 is a member of a family oflysozyme-like genes (Zhang et al., 2005 (PubMed 16014814)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89136
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81279
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00119180-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
NB100-796
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-92440
Species: Hu
Applications: IHC, IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-41184
Species: Hu, Mu, Rt
Applications: ELISA, WB

Publications for LYZL6 Antibody (NBP2-49072) (0)

There are no publications for LYZL6 Antibody (NBP2-49072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL6 Antibody (NBP2-49072) (0)

There are no reviews for LYZL6 Antibody (NBP2-49072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LYZL6 Antibody (NBP2-49072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYZL6 Products

Bioinformatics Tool for LYZL6 Antibody (NBP2-49072)

Discover related pathways, diseases and genes to LYZL6 Antibody (NBP2-49072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for LYZL6 Antibody (NBP2-49072)

Find related products by research area.

Blogs on LYZL6

There are no specific blogs for LYZL6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYZL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYZL6