LYPD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LYPD1 Antibody [NBP3-17516] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Discontinued

LYPD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYPD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LYPD1 Antibody - BSA Free

• FLJ41033
• LY6/PLAUR domain containing 1
• ly6/PLAUR domain-containing protein 1
• LYPD1
• LYPDC1
• MGC29643
• PHTS
• Putative HeLa tumor suppressor

Background

Ly6/PLAUR domain-containing protein 1 (LYPD1) is also known as Putative HeLa Tumor Suppressor (PHTS). LYPD1 has been shown to suppress cell growth by inducing apoptosis. LYPD1 may also act in the p53 tumor suppressor pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYPD1