Lyn Recombinant Protein Antigen

Images

 
There are currently no images for Lyn Protein (NBP1-83072PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lyn Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LYN.

Source: E. coli

Amino Acid Sequence: KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LYN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83072.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lyn Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ26625
  • Hck-2
  • JTK8
  • Lyn
  • tyrosine-protein kinase Lyn
  • v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
  • v-yes-1
  • Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog

Background

Src is the human homolog of the v-Src gene of the Rous sarcoma virus, also known as avian sarcoma virus or ASV. Src is the first proto-oncogenic non-receptor tyrosine kinase characterized in human. By virtue of common structural motifs, the Src family is composed of nine members in vertebrates, including Src, Yes, Fgr, Frk, Fyn, Lyn, Hck, Lck and Blk. Src-family kinases transduce signals that are involved in the control of a variety of cellular processes, including proliferation, differentiation, motility and adhesion. Src-family kinases contain an amino-terminal cell membrane anchor followed by an SH3 domain and an SH2 domain involved in modular association and activation, respectively. Src-family kinases are normally maintained in an inactive state and can be activated transiently during cellular events such as mitosis. The human Lyn gene maps to chromosome 8q13 and encodes a 505 amino acid protein. Hematopoietic tissues predominantly express Lyn, which influences normal immunoglobulin production and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB3915
Species: Hu, Mu
Applications: WB
NBP1-78295
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB7500
Species: Hu
Applications: ICC, WB
NBP1-91228
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-85677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
MAB4467
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-83072PEP
Species: Hu
Applications: AC

Publications for Lyn Protein (NBP1-83072PEP) (0)

There are no publications for Lyn Protein (NBP1-83072PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lyn Protein (NBP1-83072PEP) (0)

There are no reviews for Lyn Protein (NBP1-83072PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lyn Protein (NBP1-83072PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lyn Products

Research Areas for Lyn Protein (NBP1-83072PEP)

Find related products by research area.

Blogs on Lyn

There are no specific blogs for Lyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lyn Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LYN