Ly-6G5B Antibody - Azide and BSA Free

Western Blot: Ly-6G5B Antibody [H00058496-B01P] - Analysis of LY6G5B expression in transfected 293T cell line by LY6G5B polyclonal antibody. Lane 1: LY6G5B transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Ly-6G5B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Ly-6G5B Antibody - Azide and BSA Free (H00058496-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LY6G5B (NP_067044.2, 1 a.a. - 201 a.a.) full-length human protein. MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
• Specificity: LY6G5B - lymphocyte antigen 6 complex, locus G5B,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: LY6G5B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ly-6G5B Antibody - Azide and BSA Free

• C6orf19
• chromosome 6 open reading frame 19
• G5b
• lymphocyte antigen 6 complex locus protein G5b
• lymphocyte antigen 6 complex, locus G5B
• lymphocyte antigen-6 G5B

Background

LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LY6G5B
• Entrez:
  • 58496(Human)
• Uniprot:
  • NP_067044.2(Human)