LSM3 Antibody (4C8-2D10)

Images

 
Immunocytochemistry/ Immunofluorescence: LSM3 Antibody (4C8-2D10) [H00027258-M01] - Analysis of monoclonal antibody to LSM3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: LSM3 Antibody (4C8-2D10) [H00027258-M01] - Detection limit for recombinant GST tagged LSM3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C8-2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LSM3 Antibody (4C8-2D10) Summary

Immunogen
LSM3 (AAH07055, 1 a.a. ~ 103 a.a) full length recombinant protein with GST tag.MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGR LHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPM LFVRGDGVVLVAPPLRVG
Localization
Nuclear
Specificity
LSM3 - LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LSM3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluorescence.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LSM3 Antibody (4C8-2D10)

  • LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • SMX4
  • U6 snRNA-associated Sm-like protein LSm3
  • USS2
  • YLR438C

Background

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-92082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92083
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-45836
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001164-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-53095
Species: Hu, Mu, Rt, Po, Bv, Mk, Rb, Sh, Ze
Applications: WB, ICC/IF, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48937
Species: Hu
Applications: WB, ICC/IF, IHC
AF5866
Species: Hu
Applications: WB, IHC

Publications for LSM3 Antibody (H00027258-M01) (0)

There are no publications for LSM3 Antibody (H00027258-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM3 Antibody (H00027258-M01) (0)

There are no reviews for LSM3 Antibody (H00027258-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSM3 Antibody (H00027258-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM3 Products

Bioinformatics Tool for LSM3 Antibody (H00027258-M01)

Discover related pathways, diseases and genes to LSM3 Antibody (H00027258-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM3 Antibody (H00027258-M01)

Discover more about diseases related to LSM3 Antibody (H00027258-M01).
 

Pathways for LSM3 Antibody (H00027258-M01)

View related products by pathway.

PTMs for LSM3 Antibody (H00027258-M01)

Learn more about PTMs related to LSM3 Antibody (H00027258-M01).

Blogs on LSM3

There are no specific blogs for LSM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM3 Antibody (4C8-2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM3
Entrez
OMIM
Uniprot