LSG1 Antibody


Western Blot: LSG1 Antibody [NBP2-87752] - Host: Rabbit. Target Name: LSG1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LSG1 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human LSG1. Peptide sequence: KGVQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHL The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for LSG1 Antibody

  • EC 3.6.1
  • EC 3.6.1.-
  • FLJ11301
  • FLJ27294
  • hLsg1
  • large subunit GTPase 1 homolog (S. cerevisiae)
  • large subunit GTPase 1 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB

Publications for LSG1 Antibody (NBP2-87752) (0)

There are no publications for LSG1 Antibody (NBP2-87752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSG1 Antibody (NBP2-87752) (0)

There are no reviews for LSG1 Antibody (NBP2-87752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSG1 Antibody (NBP2-87752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LSG1 Products

Bioinformatics Tool for LSG1 Antibody (NBP2-87752)

Discover related pathways, diseases and genes to LSG1 Antibody (NBP2-87752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSG1 Antibody (NBP2-87752)

Discover more about diseases related to LSG1 Antibody (NBP2-87752).

Pathways for LSG1 Antibody (NBP2-87752)

View related products by pathway.

PTMs for LSG1 Antibody (NBP2-87752)

Learn more about PTMs related to LSG1 Antibody (NBP2-87752).

Blogs on LSG1

There are no specific blogs for LSG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LSG1 Antibody and receive a gift card or discount.


Gene Symbol LSG1