LSG1 Antibody - BSA Free

Western Blot: LSG1 Antibody [NBP2-87752] - Host: Rabbit. Target Name: LSG1. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

LSG1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human LSG1. Peptide sequence: KGVQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LSG1 Antibody - BSA Free

• EC 3.6.1
• EC 3.6.1.-
• FLJ11301
• FLJ27294
• hLsg1
• large subunit GTPase 1 homolog (S. cerevisiae)
• large subunit GTPase 1 homolog

Background

The LSG1 gene encodes a protein related to the yeast large subunit GTPase 1. The encoded protein is necessary for cell viability and may localize in the endoplasmic reticulum, nucleus and cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LSG1