LRRC2 Antibody (1G3)

Images

 
Western Blot: LRRC2 Antibody (1G3) [H00079442-M02] - Analysis of LRRC2 expression in transfected 293T cell line by LRRC2 monoclonal antibody (M02), clone 1G3.Lane 1: LRRC2 transfected lysate (Predicted MW: 42.9 ...read more
Sandwich ELISA: LRRC2 Antibody (1G3) [H00079442-M02] - Detection limit for recombinant GST tagged LRRC2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LRRC2 Antibody (1G3) Summary

Immunogen
LRRC2 (NP_078788, 272 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTYLPYSMLNLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQL
Specificity
Reacts with leucine rich repeat containing 2.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LRRC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LRRC2 Antibody (1G3)

  • leucine rich repeat containing 2
  • leucine-rich repeat-containing 2
  • leucine-rich repeat-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47266
Species: Hu, Mu
Applications: WB, IP
AF1075
Species: Hu
Applications: WB
NBP2-30589
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82029
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33120
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89344
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for LRRC2 Antibody (H00079442-M02) (0)

There are no publications for LRRC2 Antibody (H00079442-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC2 Antibody (H00079442-M02) (0)

There are no reviews for LRRC2 Antibody (H00079442-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC2 Antibody (H00079442-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRRC2 Products

Bioinformatics Tool for LRRC2 Antibody (H00079442-M02)

Discover related pathways, diseases and genes to LRRC2 Antibody (H00079442-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC2 Antibody (H00079442-M02)

Discover more about diseases related to LRRC2 Antibody (H00079442-M02).
 

Pathways for LRRC2 Antibody (H00079442-M02)

View related products by pathway.

Blogs on LRRC2

There are no specific blogs for LRRC2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC2 Antibody (1G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC2
Entrez
Uniprot