Recombinant Human LRRC17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LRRC17 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 19-441 of Human LRRC17 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LRRC17
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRRC17 Protein

  • 37 kDa leucine-rich repeat (LRR) protein
  • leucine rich repeat containing 17
  • leucine-rich repeat-containing protein 17
  • LRRC17
  • p37NB
  • P37NBH_RG318M05.3

Background

LRRC17( AAH27903, 19 a.a. - 442 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3597
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-13856
Species: Hu
Applications: IHC, IHC-P
NBP1-87048
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NBP2-16454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81128
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31664
Species: Hu
Applications: IHC, IHC-P
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-81342
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRC17 Recombinant Protein (H00010234-P01) (0)

There are no publications for LRRC17 Recombinant Protein (H00010234-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC17 Recombinant Protein (H00010234-P01) (0)

There are no reviews for LRRC17 Recombinant Protein (H00010234-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC17 Recombinant Protein (H00010234-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRRC17 Products

Bioinformatics Tool for LRRC17 Recombinant Protein (H00010234-P01)

Discover related pathways, diseases and genes to LRRC17 Recombinant Protein (H00010234-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC17 Recombinant Protein (H00010234-P01)

Discover more about diseases related to LRRC17 Recombinant Protein (H00010234-P01).
 

Pathways for LRRC17 Recombinant Protein (H00010234-P01)

View related products by pathway.

Blogs on LRRC17

There are no specific blogs for LRRC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRRC17 Antibody
NBP1-83309
TRANCE/TNFSF11/RANK L
462-TR-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRRC17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC17
Entrez