LMAN2 Antibody

Images

 
Western Blot: LMAN2 Antibody [NBP1-69475] - This Anti-LMAN2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMAN2 Antibody Summary

Immunogen
Synthetic peptides corresponding to LMAN2(lectin, mannose-binding 2) The peptide sequence was selected from the C terminal of LMAN2. Peptide sequence LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMAN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LMAN2 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LMAN2 Antibody

  • C5orf8
  • chromosome 5 open reading frame 8
  • Glycoprotein GP36b
  • GP36B
  • Lectin mannose-binding 2
  • lectin, mannose-binding 2
  • vesicular integral protein of 36 kDa
  • vesicular integral-membrane protein VIP36
  • VIP36

Background

LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6017
Species: Rt
Applications: WB
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LMAN2 Antibody (NBP1-69475) (0)

There are no publications for LMAN2 Antibody (NBP1-69475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMAN2 Antibody (NBP1-69475) (0)

There are no reviews for LMAN2 Antibody (NBP1-69475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMAN2 Antibody (NBP1-69475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMAN2 Products

Bioinformatics Tool for LMAN2 Antibody (NBP1-69475)

Discover related pathways, diseases and genes to LMAN2 Antibody (NBP1-69475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMAN2 Antibody (NBP1-69475)

Discover more about diseases related to LMAN2 Antibody (NBP1-69475).
 

Pathways for LMAN2 Antibody (NBP1-69475)

View related products by pathway.

PTMs for LMAN2 Antibody (NBP1-69475)

Learn more about PTMs related to LMAN2 Antibody (NBP1-69475).

Blogs on LMAN2

There are no specific blogs for LMAN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMAN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMAN2
Uniprot