LMAN2 Antibody


Western Blot: LMAN2 Antibody [NBP1-69475] - This Anti-LMAN2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LMAN2 Antibody Summary

Synthetic peptides corresponding to LMAN2(lectin, mannose-binding 2) The peptide sequence was selected from the C terminal of LMAN2. Peptide sequence LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LMAN2 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
LMAN2 Lysate (NBP2-65712)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LMAN2 Antibody

  • C5orf8
  • chromosome 5 open reading frame 8
  • Glycoprotein GP36b
  • GP36B
  • Lectin mannose-binding 2
  • lectin, mannose-binding 2
  • vesicular integral protein of 36 kDa
  • vesicular integral-membrane protein VIP36
  • VIP36


LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LMAN2 Antibody (NBP1-69475) (0)

There are no publications for LMAN2 Antibody (NBP1-69475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMAN2 Antibody (NBP1-69475) (0)

There are no reviews for LMAN2 Antibody (NBP1-69475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMAN2 Antibody (NBP1-69475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional LMAN2 Products

Bioinformatics Tool for LMAN2 Antibody (NBP1-69475)

Discover related pathways, diseases and genes to LMAN2 Antibody (NBP1-69475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMAN2 Antibody (NBP1-69475)

Discover more about diseases related to LMAN2 Antibody (NBP1-69475).

Pathways for LMAN2 Antibody (NBP1-69475)

View related products by pathway.

PTMs for LMAN2 Antibody (NBP1-69475)

Learn more about PTMs related to LMAN2 Antibody (NBP1-69475).

Blogs on LMAN2

There are no specific blogs for LMAN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LMAN2 Antibody and receive a gift card or discount.


Gene Symbol LMAN2