LIPJ Antibody

Images

 
Western Blot: LIPJ Antibody [NBP1-70602] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIPJ Antibody Summary

Immunogen
Synthetic peptides corresponding to LIPJ(lipase, family member J) The peptide sequence was selected from the C terminal of LIPJ. Peptide sequence LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIPJ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LIPJ and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LIPJ Antibody

  • bA425M17.2
  • FLJ11218
  • lipase J
  • lipase member J
  • lipase, family member J
  • lipase-like abhydrolase domain-containing protein 1
  • lipase-like, ab-hydrolase domain containing 1
  • LIPL1

Background

LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-98283
Species: Hu
Applications: WB
NBP2-08240
Species: Hu
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LIPJ Antibody (NBP1-70602) (0)

There are no publications for LIPJ Antibody (NBP1-70602).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIPJ Antibody (NBP1-70602) (0)

There are no reviews for LIPJ Antibody (NBP1-70602). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIPJ Antibody (NBP1-70602) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIPJ Products

LIPJ NBP1-70602

Bioinformatics Tool for LIPJ Antibody (NBP1-70602)

Discover related pathways, diseases and genes to LIPJ Antibody (NBP1-70602). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LIPJ

There are no specific blogs for LIPJ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIPJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPJ