LHPP Antibody - BSA Free

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding LHPP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-LHPP antibody (A) NBP1-83273 shows similar protein distribution across tissues to independent antibody NBP1-83272 (B).

Western Blot: LHPP Antibody [NBP1-83273] - Analysis in human cell lines A-431 and Caco-2 using anti-LHPP antibody. Corresponding LHPP RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons and glial cells.

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry: LHPP Antibody [NBP1-83273] - Representative images of lung metastasis and hematoxylin-and-eosin staining. Metastatic nodules were counted with or without a microscope and recorded. Overexpression of LHPP in MGC-803 cells significantly reduced the number of metastatic lesions in the lungs. Scale bars = 200 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35568711/) licensed under a CC-BY license.

Immunohistochemistry: LHPP Antibody [NBP1-83273] - METTL14-mediated m6A modification represses LHPP expression in GC.A The potential m6A sites were predicted by SRAMP. B, C qRT-PCR & western blot assays revealed the mRNA & protein expression, respectively, of LHPP in GC cells with knockdown or overexpression of METTL14. D IHC staining of LHPP & METTL14 in TMAs. Scale bars = 200 μm. E m6A immunoprecipitation & qRT-PCR assays showed the relative percentage of LHPP mRNA with methylation. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, ns no significant difference, GC gastric cancer, qRT-PCR quantitative reverse transcription-polymerase chain reaction, IHC immunohistochemical, TMS tissue microarrays. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP inhibits GC proliferation & metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 & KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays & colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays & colony formation. F Transwell assays with stably transfected HGC-27 & MGC-803 cells were performed. Representative images & quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP suppresses aerobic glycolysis.A Relative mRNA expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells by qPCR. B Protein expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. C IHC staining of LHPP & HIF1A in TMAs & their correlation. Scale bars = 100 μm. D Oxygen consumption rate & extracellular acidification rate of LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells were measured using the Seahorse Bioscience XF96 analyser. E Human phosphokinase microarray assay analysis of the conditioned medium from stably transfected HGC-27 cells. A summary of the relative signal intensities of the indicated proteins is shown. G, H IHC staining of LHPP & p-GSK3b in TMAs & their correlation. Scale bars = 200 μm. F Combined LHPP & GSK3b by co-immunoprecipitation. I Protein expression levels of the Wnt pathway in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, KEGG Kyoto encyclopaedia of genes & genomes, GO gene ontology, qPCR quantitative polymerase chain reaction, IHC immunohistochemical, TMA tissue microarray. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LHPP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LHPP Antibody - BSA Free (NBP1-83273) is a polyclonal antibody validated for use in IHC and WB. Anti-LHPP Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGE
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LHPP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LHPP Recombinant Protein Antigen (NBP1-83273PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29562234).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LHPP Antibody - BSA Free

• FLJ44846
• HDHD2B
• hLHPP
• MGC117251
• MGC142189
• MGC142191
• phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LHPP Antibody (NBP1-83273)(2)

Publications using NBP1-83273

• Lin J, Lian N, Gao Y Et Al. m6A Methylation Mediates LHPP Acetylation as a Tumour Aerobic Glycolysis Suppressor to Improve the Prognosis of Gastric Cancer Cell Death Dis 2022-05-14 [PMID: 35568711] (IF/IHC, Human)
• Hindupur SK, Colombi M, Fuhs SR et al. The protein histidine phosphatase LHPP is a tumour suppressor Nature 2018-03-21 [PMID: 29562234] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: LHPP