Recombinant Human Lgi4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lgi4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 438 - 537 of Human LGI4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LGI4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lgi4 Protein

  • leucine-rich glioma-inactivated gene 4
  • Leucine-rich glioma-inactivated protein 4
  • leucine-rich repeat LGI family member 4
  • leucine-rich repeat LGI family, member 4
  • LGI1-like protein 3
  • LGIL3

Background

LGI4 - leucine-rich repeat LGI family, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
MAB49081
Species: Hu
Applications: WB, IP
NBP1-76383
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB7334
Species: Hu
Applications: WB, ICC
NBP2-49512
Species: Hu
Applications: IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34980
Species: Hu
NBP2-38245
Species: Hu
Applications: IHC, IHC-P
NBP2-13738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01991
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
MAB4974
Species: Hu
Applications: IHC
NBP2-04663
Species: Hu
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00163175-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Lgi4 Partial Recombinant Protein (H00163175-Q01) (0)

There are no publications for Lgi4 Partial Recombinant Protein (H00163175-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgi4 Partial Recombinant Protein (H00163175-Q01) (0)

There are no reviews for Lgi4 Partial Recombinant Protein (H00163175-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lgi4 Partial Recombinant Protein (H00163175-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lgi4 Products

Bioinformatics Tool for Lgi4 Partial Recombinant Protein (H00163175-Q01)

Discover related pathways, diseases and genes to Lgi4 Partial Recombinant Protein (H00163175-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgi4 Partial Recombinant Protein (H00163175-Q01)

Discover more about diseases related to Lgi4 Partial Recombinant Protein (H00163175-Q01).
 

Pathways for Lgi4 Partial Recombinant Protein (H00163175-Q01)

View related products by pathway.

PTMs for Lgi4 Partial Recombinant Protein (H00163175-Q01)

Learn more about PTMs related to Lgi4 Partial Recombinant Protein (H00163175-Q01).

Blogs on Lgi4

There are no specific blogs for Lgi4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRD2 Antibody
NBP1-30475
Lgi4 Antibody
NBP2-30423
KCNJ10 Antibody
NBP1-20149

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lgi4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LGI4