Leukotriene B4 R1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Leukotriene B4 R1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LTB4R.
  
  

  Source: E. coli

  Amino Acid Sequence: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LTB4R
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89959.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Leukotriene B4 R1 Recombinant Protein Antigen

• BLT1
• chemokine receptor-like 1
• CMKRL1
• Leukotriene B4 R1
• leukotriene B4 receptor
• Leukotriene B4R1
• LTB4R
• LTB4R1
• LTBR1
• P2Y purinoceptor 7
• purinergic receptor P2Y, G-protein coupled, 7

Background

BLTR2, also known as Leukotriene B4 Receptor 1, is a Chemoattractant Receptor that causes LTB4-induced chemotaxis, calcium mobilization, and inhibition of adenylyl cyclase. Portions of the coding regions of BLTR2 have been duplicated and are part of the 5' UTR noncoding regions of the clusters LS190955 (BLT1) and LS54843 (CIDE-B) on chromosome 14. BLTR2 has been reported in humans in peripheral blood leukocytes, mononuclear lymphocytes, and spleen. ESTs have been isolated from a broad array of human libraries, including brain, eye, fetal lung/testis/B-cell, heart, kidney, melanocyte/uterus/fetal heart, testis, tonsil, and uterus libraries

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LTB4R