LDOC1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LDOC1. Source: E. coli Amino Acid Sequence: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LDOC1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57418. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for LDOC1 Recombinant Protein Antigen
Background
LDOC1, also known as Protein LDOC1, is a 146 amino acid protein that is 17 kDa, nucleus located, down-regulated in some cancer cell lines, thought to act as a regulator of the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB), and may participate in the development and/or progression of some cancers. This protein is currently being studied for research on the following diseases and disorders: breast cancer, cryptorchidism, chronic lymphocytic leukemia, lymphocytic leukemia, pancreatic cancer, thyroiditis, pancreatitis, and leukemia. Interactions with LDOC1 protein have been shown to involve over 40 proteins including FXR2, ABLIM1, NRIP1, FOSL1, and CCDC858 proteins in negative regulation of cell proliferation pathwyas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Publications for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP) (0)
There are no publications for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP) (0)
There are no reviews for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP) (0)
Additional LDOC1 Products
Research Areas for LDOC1 Recombinant Protein Antigen (NBP2-57418PEP)
Find related products by research area.
|
Blogs on LDOC1