LDOC1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related LDOC1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-14191PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LDOC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LDOC1.

Source: E. coli

Amino Acid Sequence: NSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LDOC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14191. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LDOC1 Recombinant Protein Antigen

  • BCUR1
  • breast cancer, up-regulated 1
  • Leucine zipper protein down-regulated in cancer cells
  • leucine zipper, down-regulated in cancer 1
  • Mar7
  • Mart7
  • protein LDOC1

Background

LDOC1, also known as Protein LDOC1, is a 146 amino acid protein that is 17 kDa, nucleus located, down-regulated in some cancer cell lines, thought to act as a regulator of the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB), and may participate in the development and/or progression of some cancers. This protein is currently being studied for research on the following diseases and disorders: breast cancer, cryptorchidism, chronic lymphocytic leukemia, lymphocytic leukemia, pancreatic cancer, thyroiditis, pancreatitis, and leukemia. Interactions with LDOC1 protein have been shown to involve over 40 proteins including FXR2, ABLIM1, NRIP1, FOSL1, and CCDC858 proteins in negative regulation of cell proliferation pathwyas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NBP3-45851
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-32020
Species: Hu
Applications: IHC,  IHC-P
NBP1-77925
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-23849
Species: Hu
Applications: Flow, ICC/IF,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-56122
Species: Hu
Applications: ICC/IF
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
H00009498-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16500
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for LDOC1 Protein (NBP2-14191PEP) (0)

There are no publications for LDOC1 Protein (NBP2-14191PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDOC1 Protein (NBP2-14191PEP) (0)

There are no reviews for LDOC1 Protein (NBP2-14191PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LDOC1 Protein (NBP2-14191PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LDOC1 Products

Research Areas for LDOC1 Protein (NBP2-14191PEP)

Find related products by research area.

Blogs on LDOC1

There are no specific blogs for LDOC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LDOC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LDOC1