LDOC1 Antibody


Western Blot: LDOC1 Antibody [NBP2-14191] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: LDOC1 Antibody [NBP2-14191] - Staining of human salivary gland shows strong membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LDOC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIV
Specificity of human LDOC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LDOC1 Protein (NBP2-14191PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LDOC1 Antibody

  • BCUR1
  • breast cancer, up-regulated 1
  • Leucine zipper protein down-regulated in cancer cells
  • leucine zipper, down-regulated in cancer 1
  • Mar7
  • Mart7
  • protein LDOC1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for LDOC1 Antibody (NBP2-14191) (0)

There are no publications for LDOC1 Antibody (NBP2-14191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDOC1 Antibody (NBP2-14191) (0)

There are no reviews for LDOC1 Antibody (NBP2-14191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDOC1 Antibody (NBP2-14191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LDOC1 Products

Bioinformatics Tool for LDOC1 Antibody (NBP2-14191)

Discover related pathways, diseases and genes to LDOC1 Antibody (NBP2-14191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDOC1 Antibody (NBP2-14191)

Discover more about diseases related to LDOC1 Antibody (NBP2-14191).

Pathways for LDOC1 Antibody (NBP2-14191)

View related products by pathway.

PTMs for LDOC1 Antibody (NBP2-14191)

Learn more about PTMs related to LDOC1 Antibody (NBP2-14191).

Research Areas for LDOC1 Antibody (NBP2-14191)

Find related products by research area.

Blogs on LDOC1

There are no specific blogs for LDOC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LDOC1 Antibody and receive a gift card or discount.


Gene Symbol LDOC1