LAS1L Recombinant Protein Antigen

Images

 
There are currently no images for LAS1L Protein (NBP2-38921PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LAS1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAS1L.

Source: E.coli

Amino Acid Sequence: VRWDTFPLGRMPGQTEDPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCGVGSGNCSNSSSSNFEGLLWSQGQLHGLKTG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAS1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38921.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for LAS1L Recombinant Protein Antigen

  • dJ475B7.2
  • FLJ12525
  • FLJ30133
  • FLJ45274
  • LAS1-like (S. cerevisiae)
  • protein LAS1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56590
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IF
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-30928
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
NBP1-88085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP1-88668
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90457
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
NBP1-81535
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55353
Species: Hu
Applications: ICC/IF
NBP2-38921PEP
Species: Hu
Applications: AC

Publications for LAS1L Protein (NBP2-38921PEP) (0)

There are no publications for LAS1L Protein (NBP2-38921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAS1L Protein (NBP2-38921PEP) (0)

There are no reviews for LAS1L Protein (NBP2-38921PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LAS1L Protein (NBP2-38921PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional LAS1L Products

Bioinformatics Tool for LAS1L Protein (NBP2-38921PEP)

Discover related pathways, diseases and genes to LAS1L Protein (NBP2-38921PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAS1L Protein (NBP2-38921PEP)

Discover more about diseases related to LAS1L Protein (NBP2-38921PEP).
 

Pathways for LAS1L Protein (NBP2-38921PEP)

View related products by pathway.

PTMs for LAS1L Protein (NBP2-38921PEP)

Learn more about PTMs related to LAS1L Protein (NBP2-38921PEP).

Blogs on LAS1L

There are no specific blogs for LAS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LAS1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAS1L