KvBeta2 Antibody - BSA Free

Western Blot: KvBeta2 Antibody [NBP3-10368] - Western blot analysis of KvBeta2 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KvBeta2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KvBeta2 Antibody - BSA Free (NBP3-10368) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KvBeta2. Peptide sequence KIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPME
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNAB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KvBeta2 Antibody - BSA Free

• HKvbeta2
• HKvbeta2.1
• HKvbeta2.2
• K(+) channel subunit beta-2
• K+ channel beta-2 subunit
• KCNA2BAKR6A5
• KCNK2
• KV-BETA-2
• MGC117289
• potassium channel shaker chain beta 2
• potassium voltage-gated channel, shaker-related subfamily, beta member 2
• voltage-gated potassium channel subunit beta-2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNAB2