Kv7.5 Recombinant Protein Antigen

Images

 
There are currently no images for Kv7.5 Protein (NBP1-82861PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv7.5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNQ5.

Source: E. coli

Amino Acid Sequence: LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNQ5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82861.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv7.5 Recombinant Protein Antigen

  • KCNQ5
  • KQT-like 5
  • Kv7.5
  • potassium channel protein
  • Potassium channel subunit alpha KvLQT5
  • potassium voltage-gated channel subfamily KQT member 5
  • potassium voltage-gated channel, KQT-like subfamily, member 5
  • Voltage-gated potassium channel subunit Kv7.5

Background

KCNQ5 is a gene that codes for a protein that is thought to be important in the regulation of neuronal excitability, which has 5 isoforms, with lengths of 932, 923, 942, 427, and 822 amino acids and weights of approximately 102, 101, 104, 45, and 90 kDa respectively. Current studies are being done on diseases and disorders related to this gene including pharyngitis, cerebritis, schizophrenia, and neuronitis. KCNQ5 has also been shown to have interactions with CALM1, CALM2, CALM3, DISC1, and KCNQ3 in pathways such as the synaptic transmission-ion currents, dopamine-DARPP32 feedback, potassium channels, and celecoxib pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-74102
Species: Ha, Mu
Applications: WB
NBP2-38820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-12899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, MiAr, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
NBP1-49885
Species: Bv, Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84730
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82861PEP
Species: Hu
Applications: AC

Publications for Kv7.5 Protein (NBP1-82861PEP) (0)

There are no publications for Kv7.5 Protein (NBP1-82861PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv7.5 Protein (NBP1-82861PEP) (0)

There are no reviews for Kv7.5 Protein (NBP1-82861PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv7.5 Protein (NBP1-82861PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv7.5 Products

Research Areas for Kv7.5 Protein (NBP1-82861PEP)

Find related products by research area.

Blogs on Kv7.5

There are no specific blogs for Kv7.5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv7.5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNQ5