Recombinant Human Kv7.4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Kv7.4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 596-695 of Human Kv7.4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNQ4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv7.4 GST (N-Term) Protein

  • DFNA2
  • DFNA2A
  • KCNQ4
  • KQT-like 4
  • Kv7.4
  • potassium channel KQT-like 4
  • Potassium channel subunit alpha KvLQT4
  • potassium voltage-gated channel subfamily KQT member 4
  • potassium voltage-gated channel, KQT-like subfamily, member 4
  • Voltage-gated potassium channel subunit Kv7.4

Background

KCNQ4 - potassium voltage-gated channel, KQT-like subfamily, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-12898
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
NBP1-82861
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-74102
Species: Ha, Mu
Applications: WB
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
H00007007-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-84732
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
5249-CH
Species: Hu
Applications: BA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-59791
Species: Hu
Applications: IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-49885
Species: Bv, Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for Kv7.4 Partial Recombinant Protein (H00009132-Q01) (0)

There are no publications for Kv7.4 Partial Recombinant Protein (H00009132-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv7.4 Partial Recombinant Protein (H00009132-Q01) (0)

There are no reviews for Kv7.4 Partial Recombinant Protein (H00009132-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv7.4 Partial Recombinant Protein (H00009132-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv7.4 Products

Bioinformatics Tool for Kv7.4 Partial Recombinant Protein (H00009132-Q01)

Discover related pathways, diseases and genes to Kv7.4 Partial Recombinant Protein (H00009132-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.4 Partial Recombinant Protein (H00009132-Q01)

Discover more about diseases related to Kv7.4 Partial Recombinant Protein (H00009132-Q01).
 

Pathways for Kv7.4 Partial Recombinant Protein (H00009132-Q01)

View related products by pathway.

PTMs for Kv7.4 Partial Recombinant Protein (H00009132-Q01)

Learn more about PTMs related to Kv7.4 Partial Recombinant Protein (H00009132-Q01).
 

Research Areas for Kv7.4 Partial Recombinant Protein (H00009132-Q01)

Find related products by research area.

Blogs on Kv7.4

There are no specific blogs for Kv7.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv7.4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNQ4