Kv7.2 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv7.2 Antibody [NBP1-88645] - Staining of human cerebellum shows moderate nuclear membranous positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv7.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLAFRKDPPPEPSPSQKVSLKDRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNQ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv7.2 Protein (NBP1-88645PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88645 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv7.2 Antibody

  • BFNC
  • BFNS1
  • EBN
  • EBN1
  • EIEE7
  • ENB1
  • HNSPC
  • KCNA11
  • KQT-like 2
  • Kv7.2
  • KVEBN1
  • neuroblastoma-specific potassium channel protein
  • Neuroblastoma-specific potassium channel subunit alpha KvLQT2
  • potassium voltage-gated channel subfamily KQT member 2
  • potassium voltage-gated channel, KQT-like subfamily, member 2
  • Voltage-gated potassium channel subunit Kv7.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74102
Species: Mu, ChHa
Applications: WB
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-82861
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
H00006326-Q01
Species: Hu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-04663
Species: Hu
NBL1-12154
Species: Hu
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
H00003736-B01P
Species: Hu
Applications: WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
H00006192-P01
Species: Hu
NBP1-88645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kv7.2 Antibody (NBP1-88645) (0)

There are no publications for Kv7.2 Antibody (NBP1-88645).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Kv7.2 Antibody (NBP1-88645) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: ICC.

Reviews using NBP1-88645:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Kv7.2 NBP1-88645
Enlarge
reviewed by:
Musaad Alshammari
ICC Mouse 08/08/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedAdult mouse brain tissue
SpeciesMouse
Lotr06851

Comments

Comments1%PFA fixed brain Tissue

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv7.2 Antibody (NBP1-88645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv7.2 Products

Bioinformatics Tool for Kv7.2 Antibody (NBP1-88645)

Discover related pathways, diseases and genes to Kv7.2 Antibody (NBP1-88645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv7.2 Antibody (NBP1-88645)

Discover more about diseases related to Kv7.2 Antibody (NBP1-88645).
 

Pathways for Kv7.2 Antibody (NBP1-88645)

View related products by pathway.

PTMs for Kv7.2 Antibody (NBP1-88645)

Learn more about PTMs related to Kv7.2 Antibody (NBP1-88645).

Blogs on Kv7.2

There are no specific blogs for Kv7.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Musaad Alshammari
08/08/2017
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol KCNQ2