Kv1.6 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Kv1.6 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89717PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Kv1.6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNA6.

Source: E. coli

Amino Acid Sequence: GRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89717.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv1.6 Recombinant Protein Antigen

  • FLJ25134
  • HBK2
  • human brain potassium channel-2
  • KCNA6
  • Kv1.6
  • potassium voltage-gated channel subfamily A member 6
  • potassium voltage-gated channel, shaker-related subfamily, member 6
  • Voltage-gated potassium channel HBK2
  • voltage-gated potassium channel protein Kv1.6
  • Voltage-gated potassium channel subunit Kv1.6

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage-gated, shaker-related subfamily. Kv1.6 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12. Kv1.6 is a homologue of the Drosophila gene Shaker, which is involved in reduced sleep and life expectancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-81336
Species: Hu, In
Applications: IHC,  IHC-P, WB
NB300-261
Species: Rt, Xp
Applications: IHC, IHC-Fr, WB
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-81572
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-62639
Species: Hu
Applications: IHC,  IHC-P
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB

Publications for Kv1.6 Protein (NBP1-89717PEP) (0)

There are no publications for Kv1.6 Protein (NBP1-89717PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.6 Protein (NBP1-89717PEP) (0)

There are no reviews for Kv1.6 Protein (NBP1-89717PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv1.6 Protein (NBP1-89717PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.6 Products

Array NBP1-89717PEP

Blogs on Kv1.6

There are no specific blogs for Kv1.6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv1.6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA6