KRT84 Antibody

Images

 
Immunohistochemistry-Paraffin: KRT84 Antibody [NBP2-58176] - Staining of human hair shows moderate cytoplasmic positivity in cells in external root sheath.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT84 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV
Specificity
Specificity of human KRT84 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT84
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT84 Recombinant Protein Antigen (NBP2-58176PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KRT84 Antibody

  • hair, basic, 4
  • hard keratin, type II, 4
  • K84
  • keratin 84
  • keratin, type II cuticular Hb4
  • keratin-84
  • KRTHB4
  • type II hair keratin Hb4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12400
Species: Hu
AF4400
Species: Hu
Applications: WB, IHC
H00003887-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
6507-IL/CF
Species: Hu
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00003889-P01
Species: Hu
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
H00025984-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85599
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59670
Species: Hu, Rt, Po, Bv, Ca, Eq, Rb, Sh
Applications: WB
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready

Publications for KRT84 Antibody (NBP2-58176) (0)

There are no publications for KRT84 Antibody (NBP2-58176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT84 Antibody (NBP2-58176) (0)

There are no reviews for KRT84 Antibody (NBP2-58176). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT84 Antibody (NBP2-58176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-58176

Bioinformatics Tool for KRT84 Antibody (NBP2-58176)

Discover related pathways, diseases and genes to KRT84 Antibody (NBP2-58176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT84

There are no specific blogs for KRT84, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT84 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT84