KRT84 Antibody

Images

 
Western Blot: KRT84 Antibody [NBP1-70762] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT84 Antibody Summary

Immunogen
Synthetic peptides corresponding to KRT84(keratin 84) The peptide sequence was selected from the middle region of KRT84. Peptide sequence ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT84
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KRT84 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KRT84 Antibody

  • hair, basic, 4
  • hard keratin, type II, 4
  • K84
  • keratin 84
  • keratin, type II cuticular Hb4
  • keratin-84
  • KRTHB4
  • type II hair keratin Hb4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12400
Species: Hu
Applications: WB
AF4400
Species: Hu
Applications: IHC, WB
H00003887-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
M5000
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
MAB7619
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00003889-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-30583
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85597
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-59670
Species: Hu
Applications: WB
1597-FC/CF
Species: Hu
Applications: Bind
NBP1-70762
Species: Hu
Applications: WB

Publications for KRT84 Antibody (NBP1-70762) (0)

There are no publications for KRT84 Antibody (NBP1-70762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT84 Antibody (NBP1-70762) (0)

There are no reviews for KRT84 Antibody (NBP1-70762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRT84 Antibody (NBP1-70762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT84 Products

Array NBP1-70762

Bioinformatics Tool for KRT84 Antibody (NBP1-70762)

Discover related pathways, diseases and genes to KRT84 Antibody (NBP1-70762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT84

There are no specific blogs for KRT84, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT84 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT84