KRT74 Antibody

Images

 
Immunohistochemistry-Paraffin: KRT74 Antibody [NBP2-14645] - Staining of human small intestine shows no positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT74 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISVISSSSYSYHHPSSAGVDLGASAVAGSSGSTQSGQTKTTEARGGDLKD TQGKSTPASIPARKATR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT74
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT74 Protein (NBP2-14645PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRT74 Antibody

  • HTSS2
  • K6IRS4
  • KRT5C
  • KRT6IRS4
  • KRT74 keratin 74

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17040
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14197
Species: Hu
Applications: IHC, IHC-P
NBP2-14194
Species: Hu
Applications: IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-12547
Species: Hu
NBP2-05076
Species: Hu
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29404
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC

Publications for KRT74 Antibody (NBP2-14645) (0)

There are no publications for KRT74 Antibody (NBP2-14645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT74 Antibody (NBP2-14645) (0)

There are no reviews for KRT74 Antibody (NBP2-14645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT74 Antibody (NBP2-14645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT74 Products

KRT74 NBP2-14645

Bioinformatics Tool for KRT74 Antibody (NBP2-14645)

Discover related pathways, diseases and genes to KRT74 Antibody (NBP2-14645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KRT74 Antibody (NBP2-14645)

Discover more about diseases related to KRT74 Antibody (NBP2-14645).
 

Pathways for KRT74 Antibody (NBP2-14645)

View related products by pathway.

Blogs on KRT74

There are no specific blogs for KRT74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT74 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT74