Recombinant Human KLRC4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KLRC4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-158 of Human KLRC4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KLRC4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLRC4 Protein

  • D12S2489E
  • FLJ17759
  • killer cell lectin-like receptor subfamily C, member 4
  • natual killer cell group 2-F
  • NK cell receptor F
  • NKG2-F type II integral membrane protein
  • NKG2-F
  • NKG2-F-activating NK receptor
  • NKG2FFLJ78582

Background

KLRC4( AAH17784, 1 a.a. - 159 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
MAB138
Species: Hu
Applications: Flow, CyTOF-reported
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB6549
Species: Hu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-54964
Species: Hu
Applications: WB, ICC/IF
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-54903
Species: Hu
Applications: WB
NB300-102
Species: Mu, Rt, GP, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for KLRC4 Recombinant Protein (H00008302-P01) (0)

There are no publications for KLRC4 Recombinant Protein (H00008302-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLRC4 Recombinant Protein (H00008302-P01) (0)

There are no reviews for KLRC4 Recombinant Protein (H00008302-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLRC4 Recombinant Protein (H00008302-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLRC4 Products

Bioinformatics Tool for KLRC4 Recombinant Protein (H00008302-P01)

Discover related pathways, diseases and genes to KLRC4 Recombinant Protein (H00008302-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLRC4 Recombinant Protein (H00008302-P01)

Discover more about diseases related to KLRC4 Recombinant Protein (H00008302-P01).
 

Pathways for KLRC4 Recombinant Protein (H00008302-P01)

View related products by pathway.

PTMs for KLRC4 Recombinant Protein (H00008302-P01)

Learn more about PTMs related to KLRC4 Recombinant Protein (H00008302-P01).

Blogs on KLRC4

There are no specific blogs for KLRC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
KLRC4 Antibody (1D10)
H00008302-M03
IL-15 [Unconjugated]
247-ILB-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLRC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRC4