Recombinant Human KLRA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KLRA1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 66-171 of Human KLRA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLRAP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLRA1 Protein

  • killer cell lectin-like receptor subfamily A pseudogene 1
  • KLRA#
  • KLRA1
  • Ly49
  • LY49L
  • Ly-49L
  • MGC126520
  • MGC126522

Background

KLRA1 - killer cell lectin-like receptor subfamily A, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76335
Species: Mu, Rt
Applications: WB, ELISA
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
H00010748-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for KLRA1 Partial Recombinant Protein (H00010748-Q01) (0)

There are no publications for KLRA1 Partial Recombinant Protein (H00010748-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLRA1 Partial Recombinant Protein (H00010748-Q01) (0)

There are no reviews for KLRA1 Partial Recombinant Protein (H00010748-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLRA1 Partial Recombinant Protein (H00010748-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLRA1 Products

Bioinformatics Tool for KLRA1 Partial Recombinant Protein (H00010748-Q01)

Discover related pathways, diseases and genes to KLRA1 Partial Recombinant Protein (H00010748-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KLRA1

There are no specific blogs for KLRA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KLRA1 Antibody
NBP1-76983
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLRA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRAP1