KLHL9 Antibody

Immunocytochemistry/Immunofluorescence: KLHL9 Antibody [NBP2-56152] - Staining of human cell line HeLa shows localization to cytosol.

Product Discontinued

KLHL9 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KLHL9 Antibody

• FLJ13568
• FLJ21815
• kelch-like 9 (Drosophila)
• kelch-like protein 9
• KIAA1354

Background

Substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLHL9