KLF17 Antibody

Images

 
Western Blot: KLF17 Antibody [NBP1-81917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Analysis in human testis and tonsil tissues. Corresponding KLF17 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human testis shows strong nuclear positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KLF17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 26293300). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLF17 Protein (NBP1-81917PEP)
Publications
Read Publication using
NBP1-81917 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26293300).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLF17 Antibody

  • FLJ40160
  • KLF17
  • Kruppel-like factor 17
  • Zfp393
  • Zinc finger protein 393Krueppel-like factor 17
  • ZNF393
  • ZNF393novel zinc-finger protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DPSG10
Species: Hu
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34032
Species: Hu
Applications: IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45511
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-81917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KLF17 Antibody (NBP1-81917)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KLF17 Antibody (NBP1-81917) (0)

There are no reviews for KLF17 Antibody (NBP1-81917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF17 Antibody (NBP1-81917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLF17 Products

Bioinformatics Tool for KLF17 Antibody (NBP1-81917)

Discover related pathways, diseases and genes to KLF17 Antibody (NBP1-81917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF17 Antibody (NBP1-81917)

Discover more about diseases related to KLF17 Antibody (NBP1-81917).
 

Pathways for KLF17 Antibody (NBP1-81917)

View related products by pathway.

Blogs on KLF17

There are no specific blogs for KLF17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF17