Recombinant Human KIST Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KIST Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 344 of Human UHMK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEGLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UHMK1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00127933-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KIST Protein

  • DKFZp434C1613
  • EC 2.7.11.1
  • FLJ23015
  • kinase interacting with leukemia-associated gene (stathmin)
  • Kinase interacting with stathmin
  • KISKIS protein kinase
  • KIST
  • serine/threonine-protein kinase Kist
  • U2AF homology motif (UHM) kinase 1
  • U2AF homology motif kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1555
Species: Hu
Applications: WB
NBP1-90119
Species: Hu
Applications: IHC, IHC-P
NBP2-37550
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for KIST Recombinant Protein (H00127933-P01)(1)

Reviews for KIST Recombinant Protein (H00127933-P01) (0)

There are no reviews for KIST Recombinant Protein (H00127933-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIST Recombinant Protein (H00127933-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIST Products

Bioinformatics Tool for KIST Recombinant Protein (H00127933-P01)

Discover related pathways, diseases and genes to KIST Recombinant Protein (H00127933-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIST Recombinant Protein (H00127933-P01)

Discover more about diseases related to KIST Recombinant Protein (H00127933-P01).
 

Pathways for KIST Recombinant Protein (H00127933-P01)

View related products by pathway.

PTMs for KIST Recombinant Protein (H00127933-P01)

Learn more about PTMs related to KIST Recombinant Protein (H00127933-P01).
 

Research Areas for KIST Recombinant Protein (H00127933-P01)

Find related products by research area.

Blogs on KIST

There are no specific blogs for KIST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KIST Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UHMK1