Kinesin 5A Recombinant Protein Antigen

Images

 
There are currently no images for Kinesin 5A Protein (NBP1-85344PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kinesin 5A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF5A.

Source: E. coli

Amino Acid Sequence: AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85344.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kinesin 5A Recombinant Protein Antigen

  • D12S1889
  • KIF5A variant protein
  • kinesin family member 5A
  • kinesin heavy chain isoform 5A
  • Kinesin heavy chain neuron-specific 1
  • kinesin, heavy chain, neuron-specific
  • MY050
  • Neuronal kinesin heavy chain
  • NKHC1
  • NKHCspastic paraplegia 10 (autosomal dominant)
  • SPG10

Background

Kinesin 5A is part of a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types and is subject to spatial and temporal regulation. These proteins have a modular structure including a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. There are currently three known Kinesin 5 family members denoted as A, B, and C. Kinesin 5A and kinesin 5C appear to be exclusively neuronal, whereas kinesin 5B appears to be ubiquitous in its expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
H00006683-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87429
Species: Hu
Applications: IHC,  IHC-P, WB
H00051062-M03
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF7385
Species: Hu
Applications: ICC, WB
NBP3-14647
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-83512
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-22348
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP1-93476
Species: Hu
Applications: IHC,  IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-59263
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20471
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP2-56164
Species: Hu
Applications: ICC/IF, WB

Publications for Kinesin 5A Protein (NBP1-85344PEP) (0)

There are no publications for Kinesin 5A Protein (NBP1-85344PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kinesin 5A Protein (NBP1-85344PEP) (0)

There are no reviews for Kinesin 5A Protein (NBP1-85344PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kinesin 5A Protein (NBP1-85344PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kinesin 5A Products

Research Areas for Kinesin 5A Protein (NBP1-85344PEP)

Find related products by research area.

Blogs on Kinesin 5A

There are no specific blogs for Kinesin 5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kinesin 5A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF5A