KIF20A Antibody - BSA Free

Western Blot: KIF20A Antibody [NBP2-87688] - Host: Rabbit. Target Name: KIF20A. Sample Tissue: Mouse Kidney lysates. Antibody Dilution: 1ug/ml

Product Discontinued

KIF20A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse KIF20A. Peptide sequence: EPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF20A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KIF20A Antibody - BSA Free

• FLJ21151
• GG10_2
• kinesin family member 20A
• kinesin-like protein KIF20A
• mitotic kinesin-like protein 2
• MKLP2
• Rab6-interacting kinesin-like protein
• RAB6KIFLkinesin-like (rabkinesin6)
• rabkinesin-6

Background

KIF20A is a member of the kinesin-like protein family and has 1 kinesin motor domain. It interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B and may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF20A