KIF13B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KIF13B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF13B.
  
  

  Source: E.coli

  Amino Acid Sequence: LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KIF13B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-83398.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF13B Recombinant Protein Antigen

• GAKIN
• GAKINkinesin 13B
• guanylate kinase associated kinesin
• KIAA0639kinesin-like protein KIF13B
• kinesin family member 13B
• Kinesin-like protein GAKIN

Background

KIF13B is a gene that codes for a protein whose functions include facilitating in reorginzation of the cortical cytoskeleton and advocating the formation of extra axons if needed in the regulation of their formation that has a length of 1826 amino acids and a mass of approximately 203 kDa. Studies have been conducted on diseases and disorders relating to this gene, including paraplegia, spasticity, malaria and neuronitis. KIF13B has also been shown to have interactions with DLG1, BCL6, DLG$, MARK2, and TERF2 in pathways such as the Arf6 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF13B