KIF13B Recombinant Protein Antigen

Images

 
There are currently no images for KIF13B Protein (NBP1-83398PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF13B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF13B.

Source: E.coli

Amino Acid Sequence: LTGKGKLSRRSISSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPDPGLSNLAASYLNP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF13B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83398.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF13B Recombinant Protein Antigen

  • GAKIN
  • GAKINkinesin 13B
  • guanylate kinase associated kinesin
  • KIAA0639kinesin-like protein KIF13B
  • kinesin family member 13B
  • Kinesin-like protein GAKIN

Background

KIF13B is a gene that codes for a protein whose functions include facilitating in reorginzation of the cortical cytoskeleton and advocating the formation of extra axons if needed in the regulation of their formation that has a length of 1826 amino acids and a mass of approximately 203 kDa. Studies have been conducted on diseases and disorders relating to this gene, including paraplegia, spasticity, malaria and neuronitis. KIF13B has also been shown to have interactions with DLG1, BCL6, DLG$, MARK2, and TERF2 in pathways such as the Arf6 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
396-HB/CF
Species: Hu
Applications: BA
NBP1-58310
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-17046
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97492
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00008898-M03
Species: Hu, Rt
Applications: ELISA, WB
H00002011-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-88097
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00055614-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-80033
Species: Hu
Applications: WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-02597
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83398PEP
Species: Hu
Applications: AC

Publications for KIF13B Protein (NBP1-83398PEP) (0)

There are no publications for KIF13B Protein (NBP1-83398PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF13B Protein (NBP1-83398PEP) (0)

There are no reviews for KIF13B Protein (NBP1-83398PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF13B Protein (NBP1-83398PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF13B Products

Array NBP1-83398PEP

Bioinformatics Tool for KIF13B Protein (NBP1-83398PEP)

Discover related pathways, diseases and genes to KIF13B Protein (NBP1-83398PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF13B Protein (NBP1-83398PEP)

Discover more about diseases related to KIF13B Protein (NBP1-83398PEP).
 

Pathways for KIF13B Protein (NBP1-83398PEP)

View related products by pathway.

PTMs for KIF13B Protein (NBP1-83398PEP)

Learn more about PTMs related to KIF13B Protein (NBP1-83398PEP).

Blogs on KIF13B

There are no specific blogs for KIF13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF13B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF13B