KIAA1468 Antibody

Images

 
Western Blot: KIAA1468 Antibody [NBP1-93851] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: KIAA1468 Antibody [NBP1-93851] - Staining of human cell line A-431 shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibdoy staining is shown in green.
Immunohistochemistry-Paraffin: KIAA1468 Antibody [NBP1-93851] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1468 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAYSALSCCFISEDLMVNHFLPGLRCLRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDTKTKF
Specificity
Specificity of human KIAA1468 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1468
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1468 Antibody

  • HsT3308
  • KIAA1468

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-81248
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-76981
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, ICC, IF
NBP1-50748
Species: Hu, Mu, Rt, Ca, Eq, Ha
Applications: WB, Simple Western
NBP1-82905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41309
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84351
Species: Hu
Applications: IHC, IHC-P
NBP1-85978
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88882
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59897
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-65892
Species: Hu
NBP1-82192
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
21340002
Species: Hu
Applications: WB, ELISA
NBP2-14630
Species: Hu
Applications: IHC, IHC-P
NBP1-93851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KIAA1468 Antibody (NBP1-93851) (0)

There are no publications for KIAA1468 Antibody (NBP1-93851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1468 Antibody (NBP1-93851) (0)

There are no reviews for KIAA1468 Antibody (NBP1-93851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KIAA1468 Antibody (NBP1-93851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIAA1468 Products

Bioinformatics Tool for KIAA1468 Antibody (NBP1-93851)

Discover related pathways, diseases and genes to KIAA1468 Antibody (NBP1-93851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1468 Antibody (NBP1-93851)

Discover more about diseases related to KIAA1468 Antibody (NBP1-93851).

Blogs on KIAA1468

There are no specific blogs for KIAA1468, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1468 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1468