KIAA0040 Antibody

Images

 
Immunohistochemistry: KIAA0040 Antibody [NBP2-59798] - Human placenta shows cytoplasmic and membranous positivity in trophoblasts and endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0040 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acid sequence: MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIH
Specificity
Specificity of human KIAA0040 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0040
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA0040 Recombinant Protein Antigen (NBP2-59798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for KIAA0040 Antibody

  • FLJ75822
  • hypothetical protein LOC9674
  • KIAA0040
  • MGC133301

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00063876-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
AF4210
Species: Hu
Applications: WB, IHC
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-14736
Species: Hu
Applications: IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3865
Species: Hu
Applications: WB, IHC
NBP2-19473
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NBP2-65365
Species: Hu
NBP1-91048
Species: Hu
Applications: IHC, IHC-P
AF5896
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59798
Species: Hu
Applications: IHC, IHC-P

Publications for KIAA0040 Antibody (NBP2-59798) (0)

There are no publications for KIAA0040 Antibody (NBP2-59798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0040 Antibody (NBP2-59798) (0)

There are no reviews for KIAA0040 Antibody (NBP2-59798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIAA0040 Antibody (NBP2-59798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KIAA0040 Antibody (NBP2-59798)

Discover related pathways, diseases and genes to KIAA0040 Antibody (NBP2-59798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0040 Antibody (NBP2-59798)

Discover more about diseases related to KIAA0040 Antibody (NBP2-59798).
 

Pathways for KIAA0040 Antibody (NBP2-59798)

View related products by pathway.

Blogs on KIAA0040

There are no specific blogs for KIAA0040, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0040 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0040