CASC4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CASC4 Antibody [NBP2-30492] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry: CASC4 Antibody [NBP2-30492] - Staining of human cerebral cortex shows strong cytoplasmic positivity with a granular pattern in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CASC4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CASC4 Protein (NBP2-30492PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CASC4 Antibody

  • cancer susceptibility candidate 4
  • Cancer susceptibility candidate gene 4 protein
  • DKFZp459F1927
  • gene associated with HER-2/neu overexpression
  • H63
  • MGC74708
  • protein CASC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00063876-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
AF4210
Species: Hu
Applications: WB, IHC
NBP2-14736
Species: Hu
Applications: IHC, IHC-P
NBP2-19473
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49573
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5896
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-79340
Species: Hu
Applications: WB
NBP2-30492
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CASC4 Antibody (NBP2-30492) (0)

There are no publications for CASC4 Antibody (NBP2-30492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CASC4 Antibody (NBP2-30492) (0)

There are no reviews for CASC4 Antibody (NBP2-30492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CASC4 Antibody (NBP2-30492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CASC4 Products

Bioinformatics Tool for CASC4 Antibody (NBP2-30492)

Discover related pathways, diseases and genes to CASC4 Antibody (NBP2-30492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CASC4 Antibody (NBP2-30492)

Discover more about diseases related to CASC4 Antibody (NBP2-30492).
 

Pathways for CASC4 Antibody (NBP2-30492)

View related products by pathway.

Blogs on CASC4

There are no specific blogs for CASC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CASC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASC4
Uniprot