Kelch-Like 3 Antibody - BSA Free

Western Blot: Kelch-Like 3 Antibody [NBP2-87673] - WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: THP-1 cell lysate

Immunohistochemistry: Kelch-Like 3 Antibody [NBP2-87673] - Sample Type: Human brain stem cells. Primary Antibody Dilution: 1:500. Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: KLHL3: Red DAPI:Blue. Gene Name: KLHL3. Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kelch-Like 3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human Kelch-Like 3. Peptide sequence: CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLHL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kelch-Like 3 Antibody - BSA Free

• FLJ40871
• kelch-like 3 (Drosophila)
• kelch-like protein 3
• KIAA1129kelch (Drosophila)-like 3
• MGC44594

Background

KLHL3, also known as Kelch-like protein 3; has 3 isoforms, a 65 kDa 587 amino acid isoform A, a 61 kDa 555 amino acid isoform B, and a 56 kDa 505 amino acid isoform C; acts as a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that plays a role of regulator in ion transport of the distal nephron. The BCR(KLHL3) complex may regulate the SLC12A3/NCC subcellular location at the cell membrane by mediating ubiquitination of SLC12A3/NCC. There has been research revolving around the KLHL3 protein involvement in pharyngitis and pseudohypoaldosteronism. The protein has been shown to interact with OPRD1, GNAO1, SYT2, SYNCRIP, and GNAI1 proteins in protein ubiquitination, renal sodium ion absorption, and distal tubule morphogenesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLHL3