KCTD21 Antibody

Images

 
Western Blot: KCTD21 Antibody [NBP1-79549] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCTD21 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human KCTD21The immunogen for this antibody is KCTD21. Peptide sequence VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCTD21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KCTD21 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCTD21 Antibody

  • BTB/POZ domain-containing protein KCTD21
  • KCASH2
  • potassium channel tetramerisation domain containing 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-38281
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47412
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-58788
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-79549
Species: Hu
Applications: WB

Publications for KCTD21 Antibody (NBP1-79549) (0)

There are no publications for KCTD21 Antibody (NBP1-79549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD21 Antibody (NBP1-79549) (0)

There are no reviews for KCTD21 Antibody (NBP1-79549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCTD21 Antibody (NBP1-79549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KCTD21 Antibody (NBP1-79549)

Discover related pathways, diseases and genes to KCTD21 Antibody (NBP1-79549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCTD21 Antibody (NBP1-79549)

Discover more about diseases related to KCTD21 Antibody (NBP1-79549).

PTMs for KCTD21 Antibody (NBP1-79549)

Learn more about PTMs related to KCTD21 Antibody (NBP1-79549).

Blogs on KCTD21

There are no specific blogs for KCTD21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCTD21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD21
Uniprot