KCTD20 Antibody


Western Blot: KCTD20 Antibody [NBP1-86738] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: KCTD20 Antibody [NBP1-86738] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: KCTD20 Antibody [NBP1-86738] - Staining of human anal skin shows strong cytoplasmic positivity in squamous epithelial cells.
Western Blot: KCTD20 Antibody [NBP1-86738] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

KCTD20 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Specificity of human, mouse, rat KCTD20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCTD20 Protein (NBP1-86738PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KCTD20 Antibody

  • BTB/POZ domain-containing protein KCTD20
  • potassium channel tetramerisation domain containing 20


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KCTD20 Antibody (NBP1-86738) (0)

There are no publications for KCTD20 Antibody (NBP1-86738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD20 Antibody (NBP1-86738) (0)

There are no reviews for KCTD20 Antibody (NBP1-86738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCTD20 Antibody (NBP1-86738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KCTD20 Products

Bioinformatics Tool for KCTD20 Antibody (NBP1-86738)

Discover related pathways, diseases and genes to KCTD20 Antibody (NBP1-86738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCTD20 Antibody (NBP1-86738)

Discover more about diseases related to KCTD20 Antibody (NBP1-86738).

Pathways for KCTD20 Antibody (NBP1-86738)

View related products by pathway.

Blogs on KCTD20

There are no specific blogs for KCTD20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCTD20 Antibody and receive a gift card or discount.


Gene Symbol KCTD20