KCTD20 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KCTD20 Antibody [NBP1-86738] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: KCTD20 Antibody [NBP1-86738] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: KCTD20 Antibody [NBP1-86738] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: KCTD20 Antibody [NBP1-86738] - Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: KCTD20 Antibody [NBP1-86738] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic and endothelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCTD20 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD20
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCTD20 Protein (NBP1-86738PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCTD20 Antibody - BSA Free

• BTB/POZ domain-containing protein KCTD20
• potassium channel tetramerisation domain containing 20

Background

KCTD20, also known as BTB/POZ domain-containing protein KCTD20, consists of a 419 amino acid long isoform that is 47 kDa and a shorter 253 amino acid isoform that is 29 kDa. This protein has also been shown to have interactions with MARK4, MAP3K8, UBC, and PPP1CA. KCTD20 is also called Potassium Channel Tetramerisation Domain Containing 20.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD20