Kallikrein 8/Neuropsin Antibody (2F11)

Images

 
Western Blot: Kallikrein 8/Neuropsin Antibody (2F11) [H00011202-M01] - KLK8 monoclonal antibody (M01), clone 2F11 Analysis of KLK8 expression in A-431.
Immunocytochemistry/ Immunofluorescence: Kallikrein 8/Neuropsin Antibody (2F11) [H00011202-M01] - Analysis of monoclonal antibody to KLK8 on A-431 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Kallikrein 8/Neuropsin Antibody (2F11) [H00011202-M01] - Detection limit for recombinant GST tagged KLK8 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kallikrein 8/Neuropsin Antibody (2F11) Summary

Immunogen
KLK8 (NP_009127, 97 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKG
Specificity
KLK8 - kallikrein 8 (neuropsin/ovasin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLK8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publication using H00011202-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 8/Neuropsin Antibody (2F11)

  • EC 3.4.21
  • EC 3.4.21.118
  • hK8
  • HNP
  • kallikrein 8 (neuropsin/ovasin)
  • Kallikrein 8
  • kallikrein-related peptidase 8
  • KLK8 protein type 1
  • KLK8 protein type 2
  • KLK8
  • neuropsin type 1
  • neuropsin type 2
  • Neuropsin
  • NP
  • NRPN
  • Ovasin
  • PRSS19
  • PRSS19kallikrein-8
  • Serine protease 19
  • Serine protease TADG-14
  • TADG14neuropsin
  • Tumor-associated differentially expressed gene 14 protein

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Kallikrein 8/Neuropsin Antibody (H00011202-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00011202-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Reviews for Kallikrein 8/Neuropsin Antibody (H00011202-M01) (0)

There are no reviews for Kallikrein 8/Neuropsin Antibody (H00011202-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kallikrein 8/Neuropsin Antibody (H00011202-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 8/Neuropsin Products

Research Areas for Kallikrein 8/Neuropsin Antibody (H00011202-M01)

Find related products by research area.

Blogs on Kallikrein 8/Neuropsin

There are no specific blogs for Kallikrein 8/Neuropsin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 8/Neuropsin Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK8
Entrez
OMIM
Uniprot