Kallikrein 5 Antibody

Images

 
Western Blot: Kallikrein 5 Antibody [NBP1-89588] - Analysis in control (vector only transfected HEK293T lysate) and KLK5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: Kallikrein 5 Antibody [NBP1-89588] - Staining of human skin shows distinct positivity in the keratinized layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kallikrein 5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kallikrein 5 Protein (NBP1-89588PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kallikrein 5 Antibody

  • EC 3.4.21
  • EC 3.4.21.4
  • Kallikrein 5
  • Kallikrein-like protein 2
  • kallikrein-related peptidase 5
  • KLK5
  • KLKL2
  • KLK-L2
  • KLK-L2EC 3.4.21.-
  • SCTE
  • SCTEkallikrein-5
  • Stratum corneum tryptic enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
AF2008
Species: Hu
Applications: WB, IHC, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB2337
Species: Hu
Applications: WB, IP
2626-SE
Species: Hu
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
MAB1719
Species: Hu
Applications: WB, IHC, ICC
AF2007
Species: Hu
Applications: WB
AF1595
Species: Hu
Applications: WB, IHC, IP
AF2625
Species: Hu
Applications: WB, IHC, IP, Neut
MAB4104
Species: Hu
Applications: WB, IP, Neut
AF5725
Species: Hu
Applications: WB, IHC
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
1398-TS/CF
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA

Publications for Kallikrein 5 Antibody (NBP1-89588) (0)

There are no publications for Kallikrein 5 Antibody (NBP1-89588).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 5 Antibody (NBP1-89588) (0)

There are no reviews for Kallikrein 5 Antibody (NBP1-89588). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 5 Antibody (NBP1-89588) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 5 Products

Bioinformatics Tool for Kallikrein 5 Antibody (NBP1-89588)

Discover related pathways, diseases and genes to Kallikrein 5 Antibody (NBP1-89588). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 5 Antibody (NBP1-89588)

Discover more about diseases related to Kallikrein 5 Antibody (NBP1-89588).
 

Pathways for Kallikrein 5 Antibody (NBP1-89588)

View related products by pathway.

PTMs for Kallikrein 5 Antibody (NBP1-89588)

Learn more about PTMs related to Kallikrein 5 Antibody (NBP1-89588).
 

Research Areas for Kallikrein 5 Antibody (NBP1-89588)

Find related products by research area.

Blogs on Kallikrein 5

There are no specific blogs for Kallikrein 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK5
Entrez