![Immunohistochemistry-Paraffin: Jade-1/PHF17 Antibody [NBP1-83085] - Staining of human liver shows strong granular positivity in hepatocytes.](http://images.novusbio.com/fullsize/Jade-1-PHF17-Antibody-Immunohistochemistry-Paraffin-NBP1-83085-img0002.jpg "Immunohistochemistry-Paraffin: Jade-1/PHF17 Antibody [NBP1-83085] - Staining of human liver shows strong granular positivity in hepatocytes.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | JADE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83085 | Applications | Species |
|---|---|---|
| Whipple Aj, Breton-Provencher V, Jacobs Hn Et Al. Imprinted Maternally Expressed microRNAs Antagonize Paternally Driven Gene Programs in Neurons Mol. Cell 2020-02-06 [PMID: 32032531] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | JADE1 |
![Western Blot: Jade-1/PHF17 Antibody [NBP1-83085] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/Jade-1-PHF17-Antibody-Western-Blot-NBP1-83085-img0007.jpg "Western Blot: Jade-1/PHF17 Antibody [NBP1-83085] - Analysis in human cell line SCLC-21H.")
![Western Blot: Jade-1/PHF17 Antibody [NBP1-83085] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/antibody/nbp1-83085_rabbit-polyclonal-jade-1-phf17-antibody-western-blot-342025103156..png "Western Blot: Jade-1/PHF17 Antibody [NBP1-83085] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")