ITPRIP Antibody

Images

 
Western Blot: ITPRIP Antibody [NBP1-79876] - A549 cell Lysate, 1 ug/ml and Gel concentration :12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITPRIP Antibody Summary

Immunogen
The immunogen for this antibody is ITPRIP. Peptide sequence EPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITPRIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ITPRIP and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ITPRIP Antibody

  • bA127L20.2
  • DANGERKIAA1754bA127L20
  • inositol 14,5-triphosphate receptor interacting protein
  • inositol 14,5-triphosphate receptor-interacting protein
  • Protein DANGER

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-38492
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00160365-Q01
Species: Hu
NBP2-19961
Species: Hu, Mu
Applications: WB
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-83093
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00006532-D01P
Species: Hu, Mu
Applications: WB
AF6466
Species: Hu
Applications: WB
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
NBP2-14215
Species: Hu
Applications: IHC, IHC-P
NBP1-79876
Species: Hu
Applications: WB

Publications for ITPRIP Antibody (NBP1-79876) (0)

There are no publications for ITPRIP Antibody (NBP1-79876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITPRIP Antibody (NBP1-79876) (0)

There are no reviews for ITPRIP Antibody (NBP1-79876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITPRIP Antibody (NBP1-79876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ITPRIP Antibody (NBP1-79876)

Discover related pathways, diseases and genes to ITPRIP Antibody (NBP1-79876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITPRIP Antibody (NBP1-79876)

Discover more about diseases related to ITPRIP Antibody (NBP1-79876).
 

Pathways for ITPRIP Antibody (NBP1-79876)

View related products by pathway.

Blogs on ITPRIP

There are no specific blogs for ITPRIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITPRIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPRIP
Uniprot