IST1 Antibody

Western Blot: IST1 Antibody [NBP2-85118] - Host: Rabbit. Target Name: IST1. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/mlIST1 is supported by BioGPS gene expression data to be expressed in COLO205

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IST1 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IST1. Peptide sequence: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IST1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IST1 Antibody

• IST1 homolog
• increased sodium tolerance 1 homolog (yeast)
• OLC1

Background

Proposed to be involved in specific functions of the ESCRT machinery. Is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvment in the MVB pathway is not established. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IST1